enow.com Web Search

Search results

  1. Results from the WOW.Com Content Network
  2. Exenatide - Wikipedia

    en.wikipedia.org/wiki/Exenatide

    The main side effects of exenatide use are gastrointestinal in nature, including acid or sour stomach, belching, diarrhea, heartburn, indigestion, nausea, and vomiting. [11] These tend to subside with time; [11] exenatide is therefore not meant for people with severe gastrointestinal disease.

  3. Why Experts Say This Underrated Supplement Is Key To Building ...

    www.aol.com/why-experts-underrated-supplement...

    The Best Amino Acid Supplements To Try Amino acid complexes are available in powder form, but many brands also offer oral capsules. Choose a product that is third-party tested to ensure the ...

  4. Plecanatide - Wikipedia

    en.wikipedia.org/wiki/Plecanatide

    Plecanatide is a 16 amino acid peptide with the amino acid sequence: H-Asn 1-Asp 2-Glu 3-Cys 4-Glu 5-Leu 6-Cys 7-Val 8-Asn 9-Val 10-Ala 11-Cys 12-Thr 13-Gly 14-Cys 15-Leu 16-OH (one-letter sequence: NDECELCVNVACTGCL). Plecanatide is nearly structurally identical to human uroguanylin, apart from the substitution of Asp 3 with Glu 3. [13]

  5. Prednisone - Wikipedia

    en.wikipedia.org/wiki/Prednisone

    Micrograph of fatty liver, as may be seen due to long-term prednisone use. Trichrome stain.. Short-term side effects, as with all glucocorticoids, include high blood glucose levels (especially in patients with diabetes mellitus or on other medications that increase blood glucose, such as tacrolimus) and mineralocorticoid effects such as fluid retention. [24]

  6. Insulin (medication) - Wikipedia

    en.wikipedia.org/wiki/Insulin_(medication)

    Insulin-treated athletes are perceived to have lean body mass because physiological hyperinsulinemia in human skeletal muscle improves the activity of amino acid transport, which in turn promotes protein synthesis. [78] Insulin stimulates the transport of amino acids into cells and also controls glucose metabolism.

  7. Insulin degludec - Wikipedia

    en.wikipedia.org/wiki/Insulin_degludec

    Insulin degludec is a modified insulin that has one single amino acid deleted in comparison to human insulin, and is conjugated to hexadecanedioic acid via gamma-L-glutamyl spacer at the amino acid lysine at position B29. It is included on the World Health Organization's List of Essential Medicines [11] as an equivalent to insulin glargine.

  8. Amylin - Wikipedia

    en.wikipedia.org/wiki/Amylin

    Amino acid sequence of amylin with disulfide bridge and cleavage sites of insulin degrading enzyme indicated with arrows. Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. [5] It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin).

  9. Glucagon-like peptide-2 - Wikipedia

    en.wikipedia.org/wiki/Glucagon-like_peptide-2

    Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans.GLP-2 is ...

  1. Related searches amino acid 2222 side effects diabetes prednisonecyn 10 5 mg

    amino acid 2222 side effects diabetes prednisonecyn 10 5 mg tabletsymptoms diabetes