enow.com Web Search

Search results

  1. Results from the WOW.Com Content Network
  2. Motilin - Wikipedia

    en.wikipedia.org/wiki/Motilin

    Motilin is a 22-amino acid polypeptide hormone in the motilin family that, in humans, is encoded by the MLN gene. [2]Motilin is secreted by endocrine Mo cells [3] [4] (also referred to as M cells, which are not the same as the M cells, or microfold cells, found in Peyer's patches) that are numerous in crypts of the small intestine, especially in the duodenum and jejunum. [5]

  3. Why Experts Say This Underrated Supplement Is Key To Building ...

    www.aol.com/why-experts-underrated-supplement...

    The Best Amino Acid Supplements To Try Amino acid complexes are available in powder form, but many brands also offer oral capsules. Choose a product that is third-party tested to ensure the ...

  4. Insulin glulisine - Wikipedia

    en.wikipedia.org/wiki/Insulin_glulisine

    Insulin glulisine, sold under the brand name Apidra among others, is a rapid-acting modified form of medical insulin used for the treatment of diabetes.It differs from human insulin in that the amino acid asparagine at position B3 is replaced by lysine and the lysine in position B29 is replaced by glutamic acid. [2]

  5. Insulin (medication) - Wikipedia

    en.wikipedia.org/wiki/Insulin_(medication)

    Insulin-treated athletes are perceived to have lean body mass because physiological hyperinsulinemia in human skeletal muscle improves the activity of amino acid transport, which in turn promotes protein synthesis. [78] Insulin stimulates the transport of amino acids into cells and also controls glucose metabolism.

  6. Insulin degludec - Wikipedia

    en.wikipedia.org/wiki/Insulin_degludec

    Insulin degludec is a modified insulin that has one single amino acid deleted in comparison to human insulin, and is conjugated to hexadecanedioic acid via gamma-L-glutamyl spacer at the amino acid lysine at position B29. It is included on the World Health Organization's List of Essential Medicines [11] as an equivalent to insulin glargine.

  7. Insulin analog - Wikipedia

    en.wikipedia.org/wiki/Insulin_analog

    The amino acid sequence of animal insulins in different mammals may be similar to human insulin (insulin human INN), there is however considerable viability within vertebrate species. [16] Porcine insulin has only a single amino acid variation from the human variety, and bovine insulin varies by three amino acids.

  8. Plecanatide - Wikipedia

    en.wikipedia.org/wiki/Plecanatide

    Plecanatide is a 16 amino acid peptide with the amino acid sequence: H-Asn 1-Asp 2-Glu 3-Cys 4-Glu 5-Leu 6-Cys 7-Val 8-Asn 9-Val 10-Ala 11-Cys 12-Thr 13-Gly 14-Cys 15-Leu 16-OH (one-letter sequence: NDECELCVNVACTGCL). Plecanatide is nearly structurally identical to human uroguanylin, apart from the substitution of Asp 3 with Glu 3. [13]

  9. Glucagon-like peptide-2 - Wikipedia

    en.wikipedia.org/wiki/Glucagon-like_peptide-2

    Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans.GLP-2 is ...